DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG5246

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:267 Identity:77/267 - (28%)
Similarity:123/267 - (46%) Gaps:53/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 RVVGGNETTKREFPWMALIEYTKPGNVKGHH-CGGSLINHRYVLTAAHCVSAIPSDWELTGVRLG 200
            ||:||.::.....|:...|.     |..|.| ||||:|..:::||||||:     :|.:..::: 
  Fly    41 RVIGGVDSPTGFAPYQVSIM-----NTFGEHVCGGSIIAPQWILTAAHCM-----EWPIQYLKI- 94

  Fly   201 EWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPH-----PQYPGNSRDQLNDIALLRLRDEVQY 260
                         ..|..|...|..:|.|:....|     |.|.       |||||:.....:.|
  Fly    95 -------------VTGTVDYTRPGAEYLVDGSKIHCSHDKPAYH-------NDIALIHTAKPIVY 139

  Fly   261 SDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTET--NFTSNIKLKAELDTVPTSECNQRYATQR 323
            .|...|:   .|||:.:...:|.|:.:.|||.|:|  .:::.:: |.:|:.:....|..| ....
  Fly   140 DDLTQPI---KLASKGSLPKVGDKLTLTGWGSTKTWGRYSTQLQ-KIDLNYIDHDNCQSR-VRNA 199

  Fly   324 RTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVE 388
            ..::...:|....||..||.|||||||:       ::|..:.|||::|.. |.: |:|.|:..|.
  Fly   200 NWLSEGHVCTFTQEGEGSCHGDSGGPLV-------DANQTLVGVVNWGEA-CAI-GYPDVFGSVA 255

  Fly   389 AYLNWIE 395
            .|.:|||
  Fly   256 YYHDWIE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 74/264 (28%)
Tryp_SPc 138..397 CDD:238113 76/266 (29%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 74/264 (28%)
Tryp_SPc 42..263 CDD:238113 76/266 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437257
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.