DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG17475

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:269 Identity:88/269 - (32%)
Similarity:121/269 - (44%) Gaps:41/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 GENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELT 195
            |.||.:||:.|.:....|    |..:.:..|...||.|||.:|:.|:||||||||...       
  Fly    43 GVNFQNRVINGEDVQLGE----AKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYGY------- 96

  Fly   196 GVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQY 260
                       ||.......|..:..:|...|.|||...|..|  ||.|..|||||:||.|.:::
  Fly    97 -----------NPTYLRVITGTVEYEKPDAVYFVEEHWIHCNY--NSPDYHNDIALIRLNDTIKF 148

  Fly   261 SDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTET-NFTSNIKLKAELDTVPTSECNQRYATQRR 324
            :::..|..|||..     :..|.::::.|||.||. ..|.:|..||.|..|..|.| |.......
  Fly   149 NEYTQPAELPTAP-----VANGTQLLLTGWGSTELWGDTPDILQKAYLTHVVYSTC-QEIMNNDP 207

  Fly   325 TVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEA 389
            :.....:|.....|..:|.|||||||        ..|..:.|:|::| .||.| |.|..:..|..
  Fly   208 SNGPCHICTLTTGGQGACHGDSGGPL--------THNGVLYGLVNWG-YPCAL-GVPDSHANVYY 262

  Fly   390 YLNWIENNV 398
            ||.||.:.:
  Fly   263 YLEWIRSMI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 83/257 (32%)
Tryp_SPc 138..397 CDD:238113 84/259 (32%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 83/257 (32%)
Tryp_SPc 50..269 CDD:238113 84/258 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437259
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.