DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG17477

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:276 Identity:68/276 - (24%)
Similarity:113/276 - (40%) Gaps:57/276 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 ENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSD--WEL 194
            |:|   :|||....:.:.|:...:: |..|:   |.|||::|:.|:::||.|||...|:.  ...
  Fly    24 EHF---IVGGQNAAEGDAPYQVSLQ-TLLGS---HLCGGAIISDRWIITAGHCVKGYPTSRLQVA 81

  Fly   195 TG-VRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEV 258
            || :|..|..|...||...     ..||           ...|:|.       |||.||.|.:.:
  Fly    82 TGTIRYAEPGAVYYPDAIY-----LHCN-----------YDSPKYQ-------NDIGLLHLNESI 123

  Fly   259 QYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVPTSECN------Q 317
            .::.....|.|||......    ..::|..|||    :.::...|.::|..|.....|      .
  Fly   124 TFNALTQAVELPTSPFPRG----ASELVFTGWG----SQSAAGSLPSQLQRVQQQHLNSPACESM 180

  Fly   318 RYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPG 382
            ..|.:...:....:||.....:.:|.|||||||:.:....|..|:::         ||. :|.|.
  Fly   181 MSAYEDLELGPCHICAYRQANIGACHGDSGGPLVHQGTLVGILNFFV---------PCA-QGVPD 235

  Fly   383 VYTRVEAYLNWIENNV 398
            ::..:..|.:|:...:
  Fly   236 IFMNIMYYRDWMRQTM 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 65/265 (25%)
Tryp_SPc 138..397 CDD:238113 66/267 (25%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 66/267 (25%)
Tryp_SPc 27..246 CDD:214473 65/263 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.