DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG9649

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:323 Identity:91/323 - (28%)
Similarity:138/323 - (42%) Gaps:61/323 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 QQPQWGNHPQPTQTTKPTKRSGTKLLP-----MAPNCGENFGDRVV------GGNETTKREFPWM 152
            |:|::....:|:.....|....:|..|     ::..||.   ::|:      .|.|..:.:.|||
  Fly   210 QEPEFQTSARPSVHPSNTPAQASKFYPQTIGQLSGICGR---EKVIQTPFIHNGIEVERGQLPWM 271

  Fly   153 -ALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCV----SAIPSDWELTGVRLGEWDAST-NPDCT 211
             ||.|:.  |......|||:||:.|.|::||||.    ..:|.  |.|.|.||...... :...|
  Fly   272 AALFEHV--GRDYNFLCGGTLISARTVISAAHCFRFGSRNLPG--ERTIVSLGRNSLDLFSSGAT 332

  Fly   212 VGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQYSDFILPVCLPTLASQH 276
            :|               |...:.|.||..|..... |:|||:|.:.|...|:|.|:||      .
  Fly   333 LG---------------VARLLIHEQYNPNVYTDA-DLALLQLSNHVDIGDYIKPICL------W 375

  Fly   277 NNIFL-----GRKVVVAGWGRTET-NFTSNIKLKAELDTVPTSECNQRYATQR-RTVTTKQMCAG 334
            |..||     |.|..|||||..|. |..:.:....:.|.:...||....:.:. :.:|:..:||.
  Fly   376 NENFLLELPSGHKSYVAGWGEDEKGNRNTRLAKMTDTDIITQWECRGNLSEENAKFITSHTICAS 440

  Fly   335 GVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYG---PTPCGLKGWPGVYTRVEAYLNWI 394
            ..:....|.|||||.|:|::    ...:.:.||||.|   ...|.|. .|.:||.|..::.|:
  Fly   441 NAQASGPCSGDSGGGLMLQE----QDIWMLRGVVSAGQRMTNRCNLT-LPVIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 82/278 (29%)
Tryp_SPc 138..397 CDD:238113 83/279 (30%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 81/271 (30%)
Tryp_SPc 259..497 CDD:214473 81/268 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436589
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.