DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and snk

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:410 Identity:127/410 - (30%)
Similarity:171/410 - (41%) Gaps:115/410 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YCRTP-DENSGTCINLRECGYLFELLQSEEVTEQDRRFLQASQCGYRNGQVLEKHFCFTNVQ-IC 90
            :||.. |..||.||...:|.::        :.|......:...|.:||           ||. ||
  Fly    92 FCRRSFDGRSGYCILAYQCLHV--------IREYRVHGTRIDICTHRN-----------NVPVIC 137

  Fly    91 CANSRMRNQQPQWGNH--PQPTQTTK--------------PTKR--SGTKLLPMAPNCGENFGDR 137
            |         |....|  .|....||              .|.|  ||.:.:|..|        .
  Fly   138 C---------PLADKHVLAQRISATKCQEYNAAARRLHLTDTGRTFSGKQCVPSVP--------L 185

  Fly   138 VVGGNETTKREFPWMALIEYTKPGNVKGHH----CGGSLINHRYVLTAAHCVSAIPSDWELTGVR 198
            :|||..|....||.||.:.:|:....|...    |||:|::..||||||||.::           
  Fly   186 IVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATS----------- 239

  Fly   199 LGEWDASTNPDCTVGKNGRRDCNEPYV---DYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQY 260
                 .|..||..  :.|.|..||...   |..:...:.||:|  .|....:|||||:|...|::
  Fly   240 -----GSKPPDMV--RLGARQLNETSATQQDIKILIIVLHPKY--RSSAYYHDIALLKLTRRVKF 295

  Fly   261 SDFILPVCL--------PTLASQHNNIFLGRKVVVAGWGRTE-TNFTSNIKLKAELDTVPTSECN 316
            |:.:.|.||        ||             ||.||||||| ....||...:.:||.||...|.
  Fly   296 SEQVRPACLWQLPELQIPT-------------VVAAGWGRTEFLGAKSNALRQVDLDVVPQMTCK 347

  Fly   317 QRYATQRRT---VTTKQMCAGGVE-GVDSCRGDSGGPL--LLEDYSNGNSNYYIAGVVSYGPTPC 375
            |.|..:||.   :...|.|||.:. |.|:|:||||||:  ||.:|   |...::.|:.|:|.. |
  Fly   348 QIYRKERRLPRGIIEGQFCAGYLPGGRDTCQGDSGGPIHALLPEY---NCVAFVVGITSFGKF-C 408

  Fly   376 GLKGWPGVYTRVEAYLNWIE 395
            .....||||||:.:||:|||
  Fly   409 AAPNAPGVYTRLYSYLDWIE 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855 15/63 (24%)
Tryp_SPc 137..394 CDD:214473 96/278 (35%)
Tryp_SPc 138..397 CDD:238113 99/280 (35%)
snkNP_001097766.1 CLIP 93..139 CDD:197829 17/73 (23%)
Tryp_SPc 186..430 CDD:238113 99/280 (35%)
Tryp_SPc 186..427 CDD:214473 96/277 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437435
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.