DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG13318

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:314 Identity:92/314 - (29%)
Similarity:140/314 - (44%) Gaps:51/314 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GNHPQ-PTQTTKPTKRSGTKLLPMAPN--CGENF----GDRVVGGNETTKREFPWMALIEYTKPG 161
            |.:|. ||.::..|...|......|.:  ||..|    |.......:.:...:||.|.:..|   
  Fly   122 GGYPTVPTTSSTLTCSYGLVACCQAGSYQCGRRFPPPPGSTTAAPGQASFGAYPWQAALLTT--- 183

  Fly   162 NVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELT--GVRLGEWDASTNPDCTVGKNGRRDCNEPY 224
             ...:..||:||..::||||||.|..:    .||  .||||||||::..:..           |.
  Fly   184 -ADVYLGGGALITAQHVLTAAHKVYNL----GLTYFKVRLGEWDAASTSEPI-----------PA 232

  Fly   225 VDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQYS--DFILPVCLPTLASQHNNIFLGRKVVV 287
            .|..:.....:|.:  |..:..||:|:|:|...|..:  ..:..|||||.:      |:|::..|
  Fly   233 QDVYISNVYVNPSF--NPNNLQNDVAILKLSTPVSLTSKSTVGTVCLPTTS------FVGQRCWV 289

  Fly   288 AGWGRTE---TNFTSNIKLKAELDTVPTSECNQRYATQRRTVT-----TKQMCAGGVEGVDSCRG 344
            ||||:.:   |.....|:.:.::..:|.:.|.......|...:     |..:||||..|.|:|.|
  Fly   290 AGWGKNDFGATGAYQAIERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAGGEAGKDACTG 354

  Fly   345 DSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWIENNV 398
            |.|.||:    ...|..:|:.|:|::| ..|...|.||||..|..||.||:..:
  Fly   355 DGGSPLV----CTSNGVWYVVGLVAWG-IGCAQAGVPGVYVNVGTYLPWIQTTL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 79/268 (29%)
Tryp_SPc 138..397 CDD:238113 81/270 (30%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 81/264 (31%)
Tryp_SPc 169..399 CDD:214473 79/261 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435527
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.