DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG14088

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:297 Identity:75/297 - (25%)
Similarity:110/297 - (37%) Gaps:88/297 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 SGTKLLPMAPN-CGE---NFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCG-----GSLIN 174
            |||.......| |||   .....:||         ||.|::          ||.|     |:||:
  Fly    19 SGTGSAQFLGNICGERRDGLSPDIVG---------PWTAIL----------HHFGRIVGVGTLIH 64

  Fly   175 HRYVLTAAHCVSAIPSDWELTGV---RLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHP 236
            .|::||..||..:|       ||   ||||:          |:.|    :|...|:.|.....:.
  Fly    65 ERFILTDVHCGDSI-------GVIRARLGEY----------GRIG----SELAEDHIVAAFFSNA 108

  Fly   237 QYPGNSRDQLNDIALLRLRDEVQYSDFILPVC------LPTLASQ--HNNIFLGRKVVVAGWGRT 293
            .:  |...|.|::.|::|...|.|.:.|:|||      :.|.|.:  :.|            |.|
  Fly   109 NF--NPETQANNMGLMKLLRTVVYKEHIIPVCILMDSRMQTFADELDYFN------------GTT 159

  Fly   294 ETNFTSNIKLKAELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLE-DYSN 357
            ..|...:..|:::........|.:        :...|.|||. :.:|||...||..|..| ||. 
  Fly   160 WKNSDKSPMLRSKTVIRMPQACGK--------LDHGQFCAGH-KDLDSCDEPSGAALTREIDYI- 214

  Fly   358 GNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWI 394
            |.:...:.|:.:.....|...   ..||.|.....||
  Fly   215 GPNRTVLFGIANSVEVKCSNS---RTYTDVVQLHQWI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 66/273 (24%)
Tryp_SPc 138..397 CDD:238113 68/274 (25%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 68/274 (25%)
Tryp_SPc 42..248 CDD:214473 66/272 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.