DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG18223

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:309 Identity:80/309 - (25%)
Similarity:125/309 - (40%) Gaps:72/309 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LLPMAPNCGENFGDRVVGGNETTKR-EFPW------MALIEYT------KPGNVKG--HHCGGSL 172
            |||:. :.|:..|...|  ....|| ..|:      :.|.:|.      :|..:.|  |.|||.:
  Fly    22 LLPIL-DAGDPIGSHFV--RRRAKRLSSPYFDKEKTLVLAKYVVSIRSRRPHKLFGDNHFCGGVI 83

  Fly   173 INHRYVLTAAHCV----SAIPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEER- 232
            |:..|:||:|||.    ..:.....|..|.     .:||          |..:...:...:|.: 
  Fly    84 ISRTYILTSAHCAMDKRKIVHRSRVLVVVA-----GTTN----------RLKSRKGLSLNMEVKK 133

  Fly   233 --IPHPQYPGNSRDQLNDIALLRLRDEVQYSDFILPVC-LPTLASQHNNIFLGRKVVVAGWGRTE 294
              :|......|:    |:|||:.|..::...:.::.|. |||...:.     |....|.||||..
  Fly   134 IFVPDKFTVFNT----NNIALMMLAKKLPLDNPLVGVINLPTADPEP-----GLNYTVLGWGRIF 189

  Fly   295 TN--FTSNIKLKAELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGV---DSCRGDSGGPLLLED 354
            ..  ..|:| |..:::.:|...|.::.    .....:.||||.:...   :.|.||:|.||:.  
  Fly   190 KGGPLASDI-LHIDVELLPRDICEKKV----HIFKEEMMCAGNLNNTMDENPCAGDTGSPLIF-- 247

  Fly   355 YSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWIE---NNVRA 400
                  |..:.||||| ...||.|..|.:||.|..:::||.   ||..|
  Fly   248 ------NETVFGVVSY-RVGCGSKTLPSIYTNVYMHMDWINGIMNNNEA 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 70/284 (25%)
Tryp_SPc 138..397 CDD:238113 72/289 (25%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 67/260 (26%)
Tryp_SPc 60..280 CDD:214473 65/257 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437256
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.