DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG7542

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:267 Identity:80/267 - (29%)
Similarity:127/267 - (47%) Gaps:31/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 VVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELTG-VRLGE 201
            :..|......:||:.|.:..:. || ....|||:||:|.:::|||||:....|.....| :.:|:
  Fly    27 ITNGEPAEVGQFPYQAGLNVSF-GN-WSTWCGGTLISHYWIITAAHCMDGAESVTVYLGAINIGD 89

  Fly   202 WDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQYSDFILP 266
            ..........|.|:|               .|.|..|..::  .:|||:|:||...|.::|.|..
  Fly    90 ESEEGQERIMVEKSG---------------IIVHSNYMAST--VVNDISLIRLPAFVGFTDRIRA 137

  Fly   267 VCLPTLASQHNNIFLGRKVVVAGWGRTE--TNFTSNIKLKAELDTVPTSECNQRYATQRRTVTTK 329
            ..||...:.....:...:...:||||..  ::..|.:....|:..:|.|.|...::   ..|:.|
  Fly   138 ASLPRRLNGQFPTYESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWS---GAVSEK 199

  Fly   330 QMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLK-GWPGVYTRVEAYLNW 393
            .:|.....|..:|.|||||||:   |..|||:|.| |..|:| |..|.: |:|.|:||:.:||:|
  Fly   200 MICMSTTSGKSTCHGDSGGPLV---YKQGNSSYLI-GSTSFG-TSMGCQVGFPAVFTRISSYLDW 259

  Fly   394 IENNVRA 400
            |.|::.|
  Fly   260 ILNHIIA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 76/259 (29%)
Tryp_SPc 138..397 CDD:238113 78/262 (30%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 78/262 (30%)
Tryp_SPc 27..260 CDD:214473 76/259 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436325
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.