DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG18179

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:284 Identity:81/284 - (28%)
Similarity:119/284 - (41%) Gaps:51/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 TKLLPMAPNCGENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCV 185
            |.|||.. ...|....|:|.|....:.:.|::..:.....|:.......|::|...::||||||:
  Fly    24 TSLLPQV-TISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCL 87

  Fly   186 SAIPSDWELTGVRLG-EWDASTNPDCTVGKNG------RRDCNEPYVDYPVEERIPHPQYPGNSR 243
            :.     :...:..| .|          |.||      |||           ..|.||.:|....
  Fly    88 TT-----DYVEIHYGSNW----------GWNGAFRQSVRRD-----------NFISHPNWPAEGG 126

  Fly   244 DQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELD 308
               .||.|:| ...|.::|.|..|.||:. |:.::.|:....|..|||..:....::.....::.
  Fly   127 ---RDIGLIR-TPSVGFTDLINKVALPSF-SEESDRFVDTWCVACGWGGMDNGNLADWLQCMDVQ 186

  Fly   309 TVPTSECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPT 373
            .:..|||.|.|.    ||.:..||....:|..||.|||||||:..|      |..:.||:::|..
  Fly   187 IISNSECEQSYG----TVASTDMCTRRTDGKSSCGGDSGGPLVTHD------NARLVGVITFGSV 241

  Fly   374 PCGLKGWPGVYTRVEAYLNWIENN 397
            .|  ...|..||||..||.||.:|
  Fly   242 DC--HSGPSGYTRVTDYLGWIRDN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 73/263 (28%)
Tryp_SPc 138..397 CDD:238113 74/265 (28%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 73/263 (28%)
Tryp_SPc 40..263 CDD:238113 74/265 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435863
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.