DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG8329

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:311 Identity:78/311 - (25%)
Similarity:116/311 - (37%) Gaps:75/311 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 VQICCANSRMRNQQPQWGNHPQPTQTTKPTKRSGTKLLPMAPNCGENFGDRVVGGNETTKREFPW 151
            |...||: |.||:....|..|:                           |.:|.|....:.:.|:
  Fly    12 VATVCAH-RNRNRTAHHGGGPK---------------------------DIIVNGYPAYEGKAPY 48

  Fly   152 MALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELTGVRLGE---WDASTNPDCTVG 213
            ...:...     .|...|||:|.:.:|||||||::.     :...:..|.   |:.....  ||.
  Fly    49 AVGLRMN-----NGAVGGGSVIGNNWVLTAAHCLTT-----DSVTIHYGSNRAWNGQLQH--TVN 101

  Fly   214 KNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNN 278
            ||               ....||.||.::.   :||.|:| ...|.:::.|..|.||.. ||...
  Fly   102 KN---------------NFFRHPGYPNSAG---HDIGLIR-TPYVSFTNLINKVSLPKF-SQKGE 146

  Fly   279 IFLGRKVVVAGWGRTETNFTSNIKLKAELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGVDSCR 343
            .|.....|..|||.......::.....::..:...||.:.|.    :|.:..||....:|...|.
  Fly   147 RFENWWCVACGWGGMANGGLADWLQCMDVQVISNGECARSYG----SVASTDMCTRATDGKSVCG 207

  Fly   344 GDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWI 394
            |||||.|:..|      |....||:::....|  |..|..||||..:|:||
  Fly   208 GDSGGALVTHD------NPIQVGVITFASIGC--KSGPSGYTRVSDHLDWI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855 1/3 (33%)
Tryp_SPc 137..394 CDD:214473 67/259 (26%)
Tryp_SPc 138..397 CDD:238113 69/260 (27%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 69/260 (27%)
Tryp_SPc 35..250 CDD:214473 67/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435896
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.