DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG33460

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:265 Identity:71/265 - (26%)
Similarity:110/265 - (41%) Gaps:58/265 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KREF-----PWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCV--SAIPSDWELTGVRLGEWD 203
            :.||     ||.||:.  ..|::   .|.|:||...::||||.|:  :|:.       |||||: 
  Fly    35 REEFSTSLGPWTALLH--TDGSI---FCAGTLITDVFILTAASCIRPNAVK-------VRLGEF- 86

  Fly   204 ASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQYSDFILPVC 268
                        ||.. ||...|:.|...:.:..:  |:....|:|.||:|...||.:|:|:|||
  Fly    87 ------------GRYP-NELPEDHLVHYFLMYRLF--NNESLANNIGLLKLTKRVQITDYIMPVC 136

  Fly   269 LPTLASQHNNI----FLGRKVVVAGWGRTETNFTSNIKLKAELDTVPTSECNQRYATQRRTVTTK 329
            : .|..|:..:    |:|.     .|..     .||:.|..||..: ..:...:..|.....|  
  Fly   137 I-VLNPQNQQLSTMRFIGN-----AWME-----DSNVSLTKELRPI-VIQSKPKMCTNLDLYT-- 187

  Fly   330 QMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPC-GLKGWPGVYTRVEAYLNW 393
            |.|||....:.||.|.:|..|:..........:...|:.:.....| ..:|    ||.|..:..|
  Fly   188 QFCAGHQGNLRSCDGLTGSALIQNSRYMNKYRHIQFGIATVNDMDCEESQG----YTDVLKFYWW 248

  Fly   394 IENNV 398
            |::.|
  Fly   249 IQDVV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 68/259 (26%)
Tryp_SPc 138..397 CDD:238113 70/262 (27%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 68/253 (27%)
Tryp_SPc 44..249 CDD:214473 66/250 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463515
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.