DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG10469

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:274 Identity:75/274 - (27%)
Similarity:138/274 - (50%) Gaps:38/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 GENFGD-RVVGGNETTKREFPW-MALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSD-W 192
            |:..|. |::.|.....::.|: :.|:.|.:....:.:.|||:::::|:::|||||:....|: |
  Fly    16 GQETGSLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLW 80

  Fly   193 ELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDE 257
            ::. :.:|:..:..:.:..|        |..|.       |.|.::  :.:...|||||::|..:
  Fly    81 KVL-IHVGKVKSFDDKEIVV--------NRSYT-------IVHKKF--DRKTVTNDIALIKLPKK 127

  Fly   258 VQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVPTSECNQRYATQ 322
            :.::.:|.|..||:.    ...:.|||.:::|||.|.....|.:........:...||.:::..|
  Fly   128 LTFNKYIQPAKLPSA----KKTYTGRKAIISGWGLTTKQLPSQVLQYIRAPIISNKECERQWNKQ 188

  Fly   323 -----RRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYG-PTPCGLKGWP 381
                 ::.|....:|....:|: .||||||||::|:|.|.     .:.|:||:| ...|.|| .|
  Fly   189 LGGKSKKVVHNGFICIDSKKGL-PCRGDSGGPMVLDDGSR-----TLVGIVSHGFDGECKLK-LP 246

  Fly   382 GVYTRVEAYLNWIE 395
            .|.|||.:||.||:
  Fly   247 DVSTRVSSYLKWIK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 71/264 (27%)
Tryp_SPc 138..397 CDD:238113 72/266 (27%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 71/264 (27%)
Tryp_SPc 24..260 CDD:238113 71/264 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436457
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.