DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG10472

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:282 Identity:83/282 - (29%)
Similarity:134/282 - (47%) Gaps:45/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 PMAPNCGENF-GDRVVGGNETTKREFPW-MALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSA 187
            ||....||.. ..|:.||......:||: :.|:.|...|   ...|||::|:.|:::|||||..:
  Fly    33 PMPKVHGETLPSGRITGGQIAEPNQFPYQVGLLLYITGG---AAWCGGTIISDRWIITAAHCTDS 94

  Fly   188 IPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEP-----YVDYPVEERIPHPQYPGNSRDQLN 247
            :     .|||           |..:|.:.|.:..|.     :|:  .:..|.|..:...:  ..|
  Fly    95 L-----TTGV-----------DVYLGAHDRTNAKEEGQQIIFVE--TKNVIVHEDWIAET--ITN 139

  Fly   248 DIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVP- 311
            ||:|::|...::::.:|.|..||..:..::. :.|...:.:|||:...:.|....: .:..||| 
  Fly   140 DISLIKLPVPIEFNKYIQPAKLPVKSDSYST-YGGENAIASGWGKISDSATGATDI-LQYATVPI 202

  Fly   312 --TSECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYG-PT 373
              .|.|:..|.   ..|....:|.....|:.:|.|||||||:|:|.||     .:.|..|:| ..
  Fly   203 MNNSGCSPWYF---GLVAASNICIKTTGGISTCNGDSGGPLVLDDGSN-----TLIGATSFGIAL 259

  Fly   374 PCGLKGWPGVYTRVEAYLNWIE 395
            .|.: |||||:||:..||:|||
  Fly   260 GCEV-GWPGVFTRITYYLDWIE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 76/266 (29%)
Tryp_SPc 138..397 CDD:238113 78/268 (29%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 76/266 (29%)
Tryp_SPc 47..282 CDD:238113 78/268 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436292
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.