DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and Jon65Ai

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:269 Identity:71/269 - (26%)
Similarity:113/269 - (42%) Gaps:56/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 RVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSD-------WEL 194
            |:..|....:.:.|::..:.::|.|.  |..||||:|.:.:|:||.||...:.|.       |.|
  Fly    37 RITMGYPAYEGKVPYIVGLGFSKNGG--GTWCGGSIIGNTWVMTAKHCTDGMESVTIYYGALWRL 99

  Fly   195 TGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQ 259
            . .:...|         ||::          |:     |.|..         .||:|:| ...|.
  Fly   100 Q-AQYTHW---------VGRS----------DF-----IEHGS---------GDISLIR-TPHVD 129

  Fly   260 YSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRT-ETNFTSNIKLKAELDTVPTSECNQRYATQR 323
            :...:..|.||....::|| :.|...:|:|||:| :....|......::.....|.|...|.   
  Fly   130 FWSLVNKVELPRYDDRYNN-YQGWWALVSGWGKTSDEGGVSEYLNCVDVQIGENSVCENYYG--- 190

  Fly   324 RTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVE 388
             :.:...:|....|...:|.|||||||::.|   ||..   .|:||:|.:...|...|....||.
  Fly   191 -SFSGDLICIPTPENKGTCSGDSGGPLVIHD---GNRQ---VGIVSFGSSAGCLSNGPKGMVRVT 248

  Fly   389 AYLNWIENN 397
            :||:||.:|
  Fly   249 SYLDWIRDN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 68/264 (26%)
Tryp_SPc 138..397 CDD:238113 69/266 (26%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 68/264 (26%)
Tryp_SPc 41..257 CDD:238113 69/263 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435599
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.