DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:267 Identity:73/267 - (27%)
Similarity:116/267 - (43%) Gaps:34/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 NFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELTGV 197
            |...|:..|...|..:||:...:.:.....  ...||||:|::.:|||||||.|...:.....|.
  Fly    35 NIEGRITNGKTATSGQFPYQVGLSFASTSG--SWWCGGSIIDNTWVLTAAHCTSGASAVTIYYGA 97

  Fly   198 RLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQYSD 262
            .:                  |...:.......:..:.|..|  ||....|||:|:: ...|.::.
  Fly    98 TV------------------RTSAQLVQTVSADNFVQHASY--NSIVLRNDISLIK-TPTVAFTA 141

  Fly   263 FILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTS--NIKLKAELDTVPTSECNQRYATQRRT 325
            .|..|.||.:|..::. :.|::.:.:|||:|..:.||  |.......:.|..|:|...|.:  ..
  Fly   142 LINKVELPAIAGTYST-YTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQNTYGS--LV 203

  Fly   326 VTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAY 390
            .|...:|......|.:|.|||||||:|.      |:..:.||.|:..:.....|.|..:|||.:|
  Fly   204 ATNNVICVATPNKVSTCNGDSGGPLVLV------SDSKLIGVTSFVSSAGCESGAPAGFTRVTSY 262

  Fly   391 LNWIENN 397
            |:||:.|
  Fly   263 LDWIKTN 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 69/258 (27%)
Tryp_SPc 138..397 CDD:238113 70/260 (27%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 69/258 (27%)
Tryp_SPc 40..269 CDD:238113 70/260 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436226
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.