DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG30283

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:269 Identity:88/269 - (32%)
Similarity:129/269 - (47%) Gaps:48/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 RVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELTGVRLG- 200
            :::||:.......||||::.     ...|.||||:||.:|:|||:|||:    ::.||. |||| 
  Fly    42 KILGGHNAPVASAPWMAMVM-----GEGGFHCGGTLITNRFVLTSAHCI----ANGELK-VRLGV 96

  Fly   201 -EWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQYSDFI 264
             |.:|...                  .:.|:....|..|   ..|| :|:|||||...|.|||.|
  Fly    97 LEREAEAQ------------------KFAVDAMFVHTDY---YFDQ-HDLALLRLAKRVHYSDNI 139

  Fly   265 LPVCL---PTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVPTSECNQRYATQRRTV 326
            .|:||   |.:.:...:|.   |....|||:||:..:|.:..|..|..:..|||.::|..|:  :
  Fly   140 SPICLLLDPLVKNIDEHIV---KFRTYGWGKTESRSSSRMLQKTSLFNLHRSECAKQYPHQQ--I 199

  Fly   327 TTKQMCAGGVEGVDSCRGDSGGPL-LLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAY 390
            ....:||... ..::|.||||||| .:..|.:....:.. ||.|:|...|..   ..|:|.|..:
  Fly   200 NRNHICAESA-NANTCNGDSGGPLTAIVTYDHVQMVFQF-GVTSFGHADCSK---ATVFTNVMTH 259

  Fly   391 LNWIENNVR 399
            |:||.|.||
  Fly   260 LDWIVNTVR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 83/262 (32%)
Tryp_SPc 138..397 CDD:238113 85/264 (32%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 83/262 (32%)
Tryp_SPc 43..266 CDD:238113 85/264 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.