DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG10764

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:278 Identity:84/278 - (30%)
Similarity:131/278 - (47%) Gaps:52/278 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 CGENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWEL 194
            ||.:...::.||::..:....|||.|     .|.....|||::|:.|:||:||||   :...::|
  Fly    30 CGISTRPKISGGDDAAEPNSIWMAAI-----FNSSDFQCGGTIIHMRFVLSAAHC---LVRGYDL 86

  Fly   195 TGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQ 259
            . |||                |.|:.|||...:.|.....|..:..:  :..|||.||:|.:.:.
  Fly    87 Y-VRL----------------GARNINEPAAVHTVINVFVHHDFIAS--EYRNDIGLLQLSESIV 132

  Fly   260 YSDFILPVCL---PTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTV-----PTSECN 316
            |:..:.|:|:   |.|......:...|.:   |||      ..|.||...|.|:     ..:||.
  Fly   133 YTVRVQPICIFLDPALKGSVEKLKTFRAL---GWG------NRNGKLSIMLQTIYLLHLKRNECK 188

  Fly   317 QRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYI-AGVVSYGPTPCGLKGW 380
            ::.   ...:.::|:|||...| |:|||||||||........|.:|.: .|:||:|...|  :| 
  Fly   189 RKL---NFNLNSRQICAGTKNG-DTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPEC--RG- 246

  Fly   381 PGVYTRVEAYLNWIENNV 398
            .||||.|.:|::||.:.:
  Fly   247 VGVYTDVTSYVDWISSTI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 80/265 (30%)
Tryp_SPc 138..397 CDD:238113 82/267 (31%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 80/265 (30%)
Tryp_SPc 38..263 CDD:238113 82/267 (31%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463526
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.