DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and Prss48

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001001650.1 Gene:Prss48 / 368202 MGIID:2685865 Length:312 Species:Mus musculus


Alignment Length:290 Identity:98/290 - (33%)
Similarity:131/290 - (45%) Gaps:52/290 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 SGTKLLPMAPNCGE--NFGDRVVGGNETTKREFPWMALI--EYTKPGNVKGHHCGGSLINHRYVL 179
            |.||...:...||.  :.| |:|||.:.....:||...:  :||       |.||||||:..:||
Mouse    20 SFTKKKNLQSVCGRPVHTG-RIVGGQDAALGRWPWQVSLRFDYT-------HSCGGSLISDHWVL 76

  Fly   180 TAAHCVSAIPSDWE--LTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNS 242
            |||||   |...|.  |..|.||..|...:   :.||       |.||     .||   ..|...
Mouse    77 TAAHC---IKKTWYSFLYSVWLGSIDREYS---STGK-------EYYV-----SRI---AIPDKH 120

  Fly   243 RDQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAEL 307
            |....|||||:|...|.:|..|||:|||.::.|   :.:.....|.|||:.:.....:...:.|:
Mouse   121 RHTEADIALLKLSSRVTFSSVILPICLPNISKQ---LTVPASCWVTGWGQNQEGHYPSTLQELEV 182

  Fly   308 DTVPTSECNQRY-------ATQRRTVTTKQMCAGGVEG-VDSCRGDSGGPLLLEDYSNGNSNYYI 364
            ..:.:..|.|.|       ....|.:.....|||..:. .|||:|||||||    ..:.:..:.:
Mouse   183 PVISSEACEQLYNPIGVFLPDLERVIKEDMFCAGERQSRKDSCKGDSGGPL----SCHIDGVWRL 243

  Fly   365 AGVVSYGPTPCGLKGWPGVYTRVEAYLNWI 394
            .||||:| ..|| |..|||||.|..|..||
Mouse   244 MGVVSWG-LECG-KDLPGVYTNVTYYQKWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 90/268 (34%)
Tryp_SPc 138..397 CDD:238113 91/269 (34%)
Prss48NP_001001650.1 Tryp_SPc 39..271 CDD:214473 90/268 (34%)
Tryp_SPc 40..274 CDD:238113 91/269 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.