DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and PRSS41

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:292 Identity:97/292 - (33%)
Similarity:143/292 - (48%) Gaps:44/292 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 PTKRSGTKLLPMAPNCG-ENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYV 178
            |.:....:||..|  || ......|.||.|:.:..:||.|.:...     :.|.|||||::.|:|
Human    49 PAESQEEELLSEA--CGHREIHALVAGGVESARGRWPWQASLRLR-----RRHRCGGSLLSRRWV 106

  Fly   179 LTAAHCVSA--IPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGN 241
            |:||||...  .||:|.   |:|||..:...|......:.|         |.|::.|.:|...|.
Human   107 LSAAHCFQKHYYPSEWT---VQLGELTSRPTPWNLRAYSSR---------YKVQDIIVNPDALGV 159

  Fly   242 SRDQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGR-KVVVAGWGRTETNFTS-----N 300
            .|   ||||||||...|.|:.:|.|:|:.  :|..|  |:.| ...|.|||....:.|.     |
Human   160 LR---NDIALLRLASSVTYNAYIQPICIE--SSTFN--FVHRPDCWVTGWGLISPSGTPLPPPYN 217

  Fly   301 IKLKAELDTVPTSECNQRY--ATQRRTVTTKQMCAGGVEG-VDSCRGDSGGPLLLEDYSNGNSNY 362
            :: :|::..:..:.||..:  .:.|..:.....|||..:| ||:|:|||||||:.:.    :..:
Human   218 LR-EAQVTILNNTRCNYLFEQPSSRSMIWDSMFCAGAEDGSVDTCKGDSGGPLVCDK----DGLW 277

  Fly   363 YIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWI 394
            |..|:||:| ..||....|||||.:..|.:||
Human   278 YQVGIVSWG-MDCGQPNRPGVYTNISVYFHWI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 89/267 (33%)
Tryp_SPc 138..397 CDD:238113 91/268 (34%)
PRSS41NP_001382429.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.