DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG1773

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster


Alignment Length:371 Identity:112/371 - (30%)
Similarity:162/371 - (43%) Gaps:98/371 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PDENSGTCINLRECGYLFELLQSEEVTEQDRRFLQASQCGYRNGQVLEKHFCFTNVQICCANSRM 96
            |...:|     ||.....|||..|::|:||        ||     ||                  
  Fly    21 PSSQAG-----REDWTPHELLAYEQLTQQD--------CG-----VL------------------ 49

  Fly    97 RNQQPQWGNHPQPTQTTKPTKRSGTKLLPMAPNCGENFGDRVVGGNETTKREFPWMALIEYTKPG 161
                                    :.|:|     .:....|:.||.:::....||||.:..:  |
  Fly    50 ------------------------SNLIP-----AQRLRRRITGGRKSSLLSQPWMAFLHIS--G 83

  Fly   162 NVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVD 226
            :::...|||||::..:|||||||....|...|:. |.|||.|.|:..|| |..|.:|.|..|..:
  Fly    84 DIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIR-VWLGELDISSTSDC-VTYNYQRVCALPVEE 146

  Fly   227 YPVEERIPHPQ----YPGNSRDQLNDIALLRLRDEVQYSDFILPVCLP----TLASQHNNIFLGR 283
            :.:::.|.|.:    |||      .||||::|..:|.:.|.|.|:|||    .||.   .:.||:
  Fly   147 FTIDKWILHEEFNLFYPG------YDIALIKLNKKVVFKDHIRPICLPLTDELLAF---TLQLGQ 202

  Fly   284 KVVVAGWGRTETNFTSNIKLKAELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGG 348
            ..:..||||||:...:|..::..::   |.:|     |..|  .|..:||.| :.||:|.|||||
  Fly   203 SYMAVGWGRTESRRFANSTMEVHIN---TEKC-----TDGR--DTSFLCANG-DYVDTCTGDSGG 256

  Fly   349 PLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWI 394
            ||:.:....|.:.....||||.|...|| .|....|..|..|:.||
  Fly   257 PLIWKTTLFGKARTVQFGVVSTGSQNCG-AGQKAYYMDVPTYVPWI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855 15/58 (26%)
Tryp_SPc 137..394 CDD:214473 93/264 (35%)
Tryp_SPc 138..397 CDD:238113 94/265 (35%)
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 93/264 (35%)
Tryp_SPc 62..301 CDD:238113 92/263 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7585
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.