DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and try-9

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:279 Identity:67/279 - (24%)
Similarity:102/279 - (36%) Gaps:86/279 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 GGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELTGVRLGEWDA 204
            |||:.::.||.               .|..|:|::..:::||||          |.|:     ..
 Worm    15 GGNKFSENEFV---------------QHGTGTLVSPWHIVTAAH----------LIGI-----SE 49

  Fly   205 STNPDCTVG-----------KN------------------GRRDCNEPYVDYPVEERIPHPQYPG 240
            ...|||..|           ||                  .|:|..:|..   ::.......|.|
 Worm    50 DPLPDCDTGNLREAYFVRDYKNFVAFVNVTCAVPEMCKGLHRKDMFKPLA---IKSLYIRKGYVG 111

  Fly   241 N---SRDQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTET-NFTSNI 301
            :   .|:..||||:..|.:.:::|..|.|.|||:..........|.|:.  |:||..: :...:.
 Worm   112 DGCIDRESFNDIAVFELEEPIEFSKDIFPACLPSAPKIPRIRETGYKLF--GYGRDPSDSVLESG 174

  Fly   302 KLKAELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDSG-GPLLLEDYSNGNSNYYIA 365
            |||:....|  :||:..:.      .....|...|....||.|||| |.:...|..|..   .:.
 Worm   175 KLKSLYSFV--AECSDDFP------YGGVYCTSAVNRGLSCDGDSGSGVVRTSDTRNVQ---VLV 228

  Fly   366 GVVSYGPTPCGLKGWPGVY 384
            ||:|.| .||     |.:|
 Worm   229 GVLSAG-MPC-----PELY 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 67/279 (24%)
Tryp_SPc 138..397 CDD:238113 67/279 (24%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 57/238 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.