DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and Prss33

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:XP_017173005.1 Gene:Prss33 / 353130 MGIID:2661234 Length:341 Species:Mus musculus


Alignment Length:295 Identity:95/295 - (32%)
Similarity:131/295 - (44%) Gaps:57/295 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 GTKLLPMAPNCGE-NFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHH-CGGSLINHRYVLTAA 182
            ||::...|. ||: ....|:|||.:....|:||...|::      :|.| ||||||..::||||.
Mouse    80 GTRMQECAA-CGQPRMSSRIVGGRDAQDGEWPWQTSIQH------RGAHVCGGSLIAPQWVLTAG 137

  Fly   183 HCV--SAIPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQ 245
            ||.  ...||::   .|.||......           |..:|..|  ||...:..|.|   |.|:
Mouse   138 HCFPRRVWPSEY---SVLLGALSLDV-----------RSSHELLV--PVLRVLLPPDY---SEDE 183

  Fly   246 L-NDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLK----- 304
            . .|:|||:||..|..|..|.|||||...|....   |....|.|||    :.:..:.|.     
Mouse   184 ARGDLALLQLRHPVSLSTRIQPVCLPAPGSHPPP---GSPCWVTGWG----SLSPGVPLPKGRPL 241

  Fly   305 --AELDTVPTSECNQRY------ATQRRTVTTKQMCAGGVEG-VDSCRGDSGGPLLLEDYSNGNS 360
              ..:..:.:..|::.|      ....|.|....:|||...| .|:|:|||||||...:    :.
Mouse   242 QGVRVPLLDSRACDRLYHVGANVPQGERIVLPGNLCAGYRRGHKDACQGDSGGPLTCME----SG 302

  Fly   361 NYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWIE 395
            ::.:.||||:| ..|.|...|||||.|..|..||:
Mouse   303 HWVLVGVVSWG-KGCALPNRPGVYTNVAKYSPWIQ 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 88/274 (32%)
Tryp_SPc 138..397 CDD:238113 89/276 (32%)
Prss33XP_017173005.1 Tryp_SPc 98..336 CDD:238113 88/274 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.