DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG4650

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:286 Identity:75/286 - (26%)
Similarity:119/286 - (41%) Gaps:55/286 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LLPMAPNCGENFGDR---VVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHC 184
            |||: |...:....|   :..|........||||.:..::...|    |||::|..:.|||||||
  Fly    14 LLPV-PGSSQYLDGRCGLLTNGKIANNISSPWMAYLHTSELLYV----CGGTVITEKLVLTAAHC 73

  Fly   185 VSAIPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYV-DYPVEERIPHPQYPGNSRDQLND 248
            ..|.    |....|:||:            .|..|.|:..: :|.|.:...|..|  |:....||
  Fly    74 TRAS----EQLVARIGEF------------IGTDDANDTMLSEYQVSQTFIHSLY--NTTTSAND 120

  Fly   249 IALLRLRDEVQYSDFILPVCLP--TLASQH-NNIFLGRKVVVAG--WGRTETNFTSNIKLKAELD 308
            ||:|.|..::.:|..|.|:|:.  |:..:: :||     .|::|  ||.......|:.....::.
  Fly   121 IAILGLATDIVFSKTIRPICIVWWTIWRKYIDNI-----QVLSGAQWGLPNDRNESDAFRITDIR 180

  Fly   309 TVPTSECNQRYATQRRTVTTKQMCAGGVEGVDS----CRGDSGGPL-LLEDYSNGNSNYYIAGVV 368
            ..|.:.|:....|   .:.:.|.|||     ||    |..|...|| .:..:.| ...|.:.|:.
  Fly   181 RQPANMCSTLNGT---AILSSQFCAG-----DSDSKLCNVDFSSPLGAIITFKN-IQRYVLIGIA 236

  Fly   369 SYGPTPCGLKGWPGVYTRVEAYLNWI 394
            :.. ..|..   ..|||.|.::.::|
  Fly   237 TTN-QKCKR---ASVYTDVLSHTDFI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 70/270 (26%)
Tryp_SPc 138..397 CDD:238113 70/268 (26%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 69/264 (26%)
Tryp_SPc 33..258 CDD:304450 69/264 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463636
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.