DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and Jon25Biii

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_608881.1 Gene:Jon25Biii / 33706 FlyBaseID:FBgn0031653 Length:258 Species:Drosophila melanogaster


Alignment Length:265 Identity:75/265 - (28%)
Similarity:106/265 - (40%) Gaps:51/265 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 RVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELTGVRLGE 201
            |:..|....:.:.|:...:.::     .|..||||:|.|.:||||.||:....|.....|   ..
  Fly    36 RITNGYAAPEGKAPYTVGLGFS-----GGWWCGGSIIAHDWVLTAEHCIGDAASVIVYFG---AT 92

  Fly   202 WDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLN-DIALLRLRDEVQYSDFIL 265
            |..:.....|||.                         ||.....| ||||:|: ..|.:...:.
  Fly    93 WRTNAQFTHTVGN-------------------------GNFIKHSNADIALIRI-PHVDFWHMVN 131

  Fly   266 PVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLK-AELDTVPTSECNQRYATQRRTVTTK 329
            .|.||:...::|| :.....|..|||.|.........|: .:|..|...||...|.    :|...
  Fly   132 KVELPSYNDRYNN-YNEWWAVACGWGGTYDGSPLPDWLQCVDLQIVHNEECGWTYG----SVGDN 191

  Fly   330 QMCAGGVEGVDSCRGDSGGPLLLEDYSN--GNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLN 392
            .:|...|:|...|.|||||||:..|.|.  |.||:    |.|.|   | ..|.|..:.||..:|:
  Fly   192 VICTRTVDGKSICGGDSGGPLVTHDGSKLVGVSNF----VSSNG---C-QSGAPAGFQRVTYHLD 248

  Fly   393 WIENN 397
            ||.::
  Fly   249 WIRDH 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 73/260 (28%)
Tryp_SPc 138..397 CDD:238113 74/262 (28%)
Jon25BiiiNP_608881.1 Tryp_SPc 36..250 CDD:214473 73/260 (28%)
Tryp_SPc 37..253 CDD:238113 74/262 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435797
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.