DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and prss60.3

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:278 Identity:89/278 - (32%)
Similarity:132/278 - (47%) Gaps:43/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 CGE-NFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWE 193
            ||: ....|:|||...:...:||...:...|.|   ||.||||||:..:|||||||:|.:     
Zfish    27 CGQAPLNTRIVGGVNASPGSWPWQVSLHSPKYG---GHFCGGSLISSEWVLTAAHCLSGV----- 83

  Fly   194 LTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEV 258
                      :.|.....:|:..::..|.......|.:...|..|..|:.|  ||||||||...|
Zfish    84 ----------SETTLVVYLGRRTQQGINIYETSRNVAKSFVHSSYNSNTND--NDIALLRLSSAV 136

  Fly   259 QYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAE-------LDTVPTSECN 316
            .::::|.|||   ||:|::....|....:.|||    :..:.:.|.|.       :..|....||
Zfish   137 TFTNYIRPVC---LAAQNSVYSAGTSSWITGWG----DIQAGVNLPAPGILQETMIPVVANDRCN 194

  Fly   317 QRYATQRRTVTTKQMCAGGVE-GVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGW 380
            ....:  .|||...:|||..: |.|:|:||||||::    :...:.:..||:.|:| ..|.....
Zfish   195 ALLGS--GTVTNNMICAGLTQGGKDTCQGDSGGPMV----TRLCTVWVQAGITSWG-YGCADPNS 252

  Fly   381 PGVYTRVEAYLNWIENNV 398
            |||||||..|.:||.:.:
Zfish   253 PGVYTRVSQYQSWISSKI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 85/264 (32%)
Tryp_SPc 138..397 CDD:238113 86/266 (32%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 86/266 (32%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.