DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and sphe

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:267 Identity:69/267 - (25%)
Similarity:117/267 - (43%) Gaps:48/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 RVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELTGVRLGE 201
            |::||.:.......:.|.:...     ..|.||||:::...:||.||||.           |.|:
  Fly    25 RIMGGEDADATATTFTASLRVD-----NAHVCGGSILSQTKILTTAHCVH-----------RDGK 73

  Fly   202 WDASTNPDCTVGKN----GRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQYSD 262
            ...::...|.||..    |.:..|       ||....||.|...:    |::|::.|..|:.|:|
  Fly    74 LIDASRLACRVGSTNQYAGGKIVN-------VESVAVHPDYYNLN----NNLAVITLSSELTYTD 127

  Fly   263 FILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLK-AELDTVPTSECNQRYATQRRTV 326
            .|  ..:|.:||.......|.:|:||||||| ::.|::.|:: ..|...|.:.|...|:..    
  Fly   128 RI--TAIPLVASGEALPAEGSEVIVAGWGRT-SDGTNSYKIRQISLKVAPEATCLDAYSDH---- 185

  Fly   327 TTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYL 391
            ..:..|........:|.||.||..:.     ||:   :.|:.::....||.: :|.|:.|:.:|.
  Fly   186 DEQSFCLAHELKEGTCHGDGGGGAIY-----GNT---LIGLTNFVVGACGSR-YPDVFVRLSSYA 241

  Fly   392 NWIENNV 398
            :||:..:
  Fly   242 DWIQEQI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 67/261 (26%)
Tryp_SPc 138..397 CDD:238113 68/263 (26%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 65/247 (26%)
Tryp_SPc 42..244 CDD:214473 63/244 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436523
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.