DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG8952

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:267 Identity:74/267 - (27%)
Similarity:127/267 - (47%) Gaps:42/267 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 DRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELTGVRLG 200
            :|:|.|::....:|||..:::.....::.   ||||:|:..:|||||||.:.:.|.:.:.|    
  Fly    36 NRIVSGSDAKLGQFPWQVILKRDAWDDLL---CGGSIISDTWVLTAAHCTNGLSSIFLMFG---- 93

  Fly   201 EWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQL-NDIALLRLRDEVQYSDFI 264
                      ||..     .|...::......|.||.|    .|:| ||::|::|.:.:.:|..|
  Fly    94 ----------TVDL-----FNANALNMTSNNIIIHPDY----NDKLNNDVSLIQLPEPLTFSANI 139

  Fly   265 LPVCLPTLASQHNNI--FLGRKVVVAGWGRTETNFT--SNIKLKAELDTVPTSECNQRYATQRRT 325
            ..:   .|..|:.:.  ::|....:||:|.||..:.  |...|.|:::.:..::|...|.  :..
  Fly   140 QAI---QLVGQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIYG--KYV 199

  Fly   326 VTTKQMCAGGVEGVD--SCRGDSGGPLLLEDYSNGNSNYYIAGVVSY-GPTPCGLKGWPGVYTRV 387
            |....|||.|.:|.|  :|.|||||||:|  |:.....:...|:.|: ....|..: .|..|.||
  Fly   200 VVDSTMCAKGFDGSDMSTCTGDSGGPLIL--YNKTIQQWQQIGINSFVAEDQCTYR-LPSGYARV 261

  Fly   388 EAYLNWI 394
            .::|.:|
  Fly   262 SSFLGFI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 73/264 (28%)
Tryp_SPc 138..397 CDD:238113 73/265 (28%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 73/264 (28%)
Tryp_SPc 38..271 CDD:238113 73/265 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436490
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.