DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG31205

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:305 Identity:78/305 - (25%)
Similarity:129/305 - (42%) Gaps:69/305 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 TTKPTKRSGTKLLPMAPNCG-----ENFGDRVVGGNETTKREFPWMA-LIEYTKPGNVKGHHCGG 170
            |..||.::.:    :...||     :...|.::.  |.|  |.||:. ::..||.|: ....|.|
  Fly    15 TLHPTIQAAS----VGQECGIFNEKQYNSDNIIA--EPT--EHPWVVRIVGVTKDGS-NTLLCTG 70

  Fly   171 SLINHRYVLTAAHCVSAIPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPH 235
            .||:.|.|:|||||||...|: .:.||..|:.|:|             :.|      .|.....|
  Fly    71 ILIDSRRVVTAAHCVSKDESE-SIYGVVFGDSDSS-------------NIN------LVSAVTVH 115

  Fly   236 PQYPGNSRDQLNDIALLRLRDEVQYSDFILPVCLPTLA-----SQHNNIFLGRKVVVAGW----- 290
            |.|  :.|...||:|::.|..||.:||.:.|:|||:::     |:.:|    .|::|||.     
  Fly   116 PDY--SPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSN----SKLIVAGLEGPSF 174

  Fly   291 -GRTETNFTSNIKLKAELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLED 354
             .|.......:.::|.....:.:.||:::.|.     ..:::..|..|     |....|..|.| 
  Fly   175 DRRHSATQRLDKRIKMTYTKIDSKECHEKQAR-----FPEELICGHTE-----RSPLSGSALTE- 228

  Fly   355 YSNGNSNYYIAGVVSYGPTPCGL--KGWPGVYTRVEAYLNWIENN 397
            .|.....:::.|:...|.....|  :|    |..:..:|:||..|
  Fly   229 ASGTPRQFHLLGIAVAGFFSSDLDHQG----YLNIRPHLDWISKN 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 69/270 (26%)
Tryp_SPc 138..397 CDD:238113 71/272 (26%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 49/154 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.