DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and sphinx1

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:293 Identity:63/293 - (21%)
Similarity:114/293 - (38%) Gaps:75/293 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LLPMAPNCGE--NFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCV 185
            :|.:..:.||  ....|:.||.........::..|.|.|......::..|::|:::::||..   
  Fly     9 VLSLTVSVGEKNKLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGTIISNQWILTVK--- 70

  Fly   186 SAIPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQ------YPGNSR- 243
                                     ||.|..       |::..:..|..:..      |..|.| 
  Fly    71 -------------------------TVLKYS-------YIEVHLASRRSYRGFDIIRIYKENFRF 103

  Fly   244 --DQLNDIALLRLRDEVQYSDF---ILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKL 303
              |..:.|||::    ..|..|   :..|.:|...::... ::|...:|.|:| ||..   :.||
  Fly   104 HYDNDHVIALVK----CPYQKFDRRMDRVRVPAYDTRFER-YVGNMTMVCGYG-TEKR---HAKL 159

  Fly   304 K-----AELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGVDS-CRGDSGGPLLLEDYSNGNSNY 362
            .     .|::.:..:||.:.|.    .:...:||..| ||... |.||.||.::    :.|.:..
  Fly   160 PEWMRCIEVEVMNNTECAKYYT----PLKWYEMCTSG-EGFKGVCEGDIGGAVV----TMGPNPT 215

  Fly   363 YIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWIE 395
            :| |::...|..|.: |:|.|:.||..::.||:
  Fly   216 FI-GIIWLMPENCSI-GYPSVHIRVSDHIKWIK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 58/274 (21%)
Tryp_SPc 138..397 CDD:238113 59/276 (21%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 58/274 (21%)
Tryp_SPc 26..248 CDD:304450 59/276 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436391
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.