DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG11664

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:234 Identity:62/234 - (26%)
Similarity:96/234 - (41%) Gaps:46/234 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 GSLINHRYVLTAAHCVSAIPSDWELT---GVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEE 231
            |||.:.|||||.|||........||:   |.|...|:..       ||.             |..
  Fly    49 GSLFSARYVLTVAHCFKKNTKPEELSVRAGYRWIAWEFR-------GKQ-------------VAG 93

  Fly   232 RIPHPQY-PGNSRDQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTET 295
            .:.||:: |...|   ||||:||::..:.:|..|..:.|.:......|:|...: .:|||..  .
  Fly    94 LLRHPKFSPLTLR---NDIAVLRVKAAISHSHMINYIGLCSRPLTPLNMFAPPQ-ELAGWNL--M 152

  Fly   296 NFTSNIKLKAELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNS 360
            :....:| ...:...|...|.|.:.    .::...:||....|...|.||||.||:    |.|. 
  Fly   153 HIAQPLK-SMSVQVEPEKNCRQWFP----QISGGVICASATMGEGLCYGDSGDPLI----SGGE- 207

  Fly   361 NYYIAGV-VSYGPTPCGLKGWPGVYTRVEAYLNWIENNV 398
               :.|: :::  ..||.|.:|.::|.|..:..:|...|
  Fly   208 ---VCGLAIAF--RKCGDKRYPALFTDVHYHRAFIAQAV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 60/228 (26%)
Tryp_SPc 138..397 CDD:238113 61/231 (26%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 61/230 (27%)
Tryp_SPc 38..237 CDD:214473 60/228 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.