DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and Tpsg1

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:290 Identity:98/290 - (33%)
Similarity:141/290 - (48%) Gaps:47/290 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 GTKLLPMAPNCGE----NFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLT 180
            |..||...|.||:    :.|.|:|||:......:||.|.:...|.     |.|||||::..:|||
  Rat     8 GFLLLLAVPGCGQPQVSHAGSRIVGGHAAQAGAWPWQASLRLQKV-----HVCGGSLLSPEWVLT 67

  Fly   181 AAHCVSAI--PSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSR 243
            ||||.|..  .||:|   |.|||...:.:|..:..|.        .:.|   ...|.|  ||:| 
  Rat    68 AAHCFSGSVNSSDYE---VHLGELTITLSPHFSTVKQ--------IIMY---SSAPGP--PGSS- 115

  Fly   244 DQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNF----TSNIKLK 304
               .||||::|...|..|..:.|||||..::..:.   |.:..|.|||.|:...    ..|:: :
  Rat   116 ---GDIALVQLATPVALSSQVQPVCLPEASADFHP---GMQCWVTGWGYTQEGEPLKPPYNLQ-E 173

  Fly   305 AELDTVPTSECNQRYATQRRT-VTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVV 368
            |::..|....|:|.|::...: :.:..:||.|..  |:|:.||||||:    ......:..||||
  Rat   174 AKVSVVDVETCSQAYSSSNGSLIQSDMLCAWGPG--DACQDDSGGPLV----CRVAGIWQQAGVV 232

  Fly   369 SYGPTPCGLKGWPGVYTRVEAYLNWIENNV 398
            |:| ..||....||||.||.||:|||..::
  Rat   233 SWG-EGCGRPDRPGVYARVTAYVNWIHRHI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 89/263 (34%)
Tryp_SPc 138..397 CDD:238113 90/265 (34%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 89/263 (34%)
Tryp_SPc 30..260 CDD:238113 90/265 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.