DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and Prss30

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:270 Identity:87/270 - (32%)
Similarity:128/270 - (47%) Gaps:37/270 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 RVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELTGVRLGE 201
            ::|||.:..:..:||...:...|    :||.||||||:..:|||||||... |.:.....|::|.
  Rat    30 KIVGGQDAPEGRWPWQVSLRTEK----EGHICGGSLIHEVWVLTAAHCFCR-PLNSSFYHVKVGG 89

  Fly   202 WDAS-TNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQYSDFIL 265
            ...| |.|..|:              ..|.....:|.|....... .|||||||...:|.|.| .
  Rat    90 LTLSLTEPHSTL--------------VAVRNIFVYPTYLWEDASS-GDIALLRLDTPLQPSQF-S 138

  Fly   266 PVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVPTSECNQRY------ATQRR 324
            |||||...:.   :..|....|.|||.|.....:::..:..:..:.:.:|.:.|      .:.:|
  Rat   139 PVCLPQAQAP---LTPGTVCWVTGWGATHERELASVLQELAVPLLDSEDCERMYHIGETSLSGKR 200

  Fly   325 TVTTKQMCAGGVEG-VDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVE 388
            .:.:..:|||.||| .|||:|||||||:...    ||::...|:.|:| ..|.....|||||||.
  Rat   201 VIQSDMLCAGFVEGQKDSCQGDSGGPLVCAI----NSSWIQVGITSWG-IGCARPNKPGVYTRVP 260

  Fly   389 AYLNWIENNV 398
            .|::||:..:
  Rat   261 DYVDWIQRTL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 85/264 (32%)
Tryp_SPc 138..397 CDD:238113 87/266 (33%)
Prss30NP_955403.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.