DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG18636

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:274 Identity:80/274 - (29%)
Similarity:118/274 - (43%) Gaps:33/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 PNCG----ENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAI 188
            |.||    .....|::.|:.......|||..:..|....|    ||||||..:.|||||||..| 
  Fly    31 PACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFV----CGGSLITDKLVLTAAHCFIA- 90

  Fly   189 PSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLR 253
              :..|. .||||::.:.:.:||......|:      ::.|:....|..|..|:  ..||||:||
  Fly    91 --NQHLV-ARLGEYERTRSEECTGYYCNFRE------EHMVDAGFKHKLYDPNT--HANDIAILR 144

  Fly   254 LRDEVQYSDFILPVCLPTLASQHN-NIFLGR--KVVVAGWGRTETNFTSNIKLKAELDTVPTSEC 315
            |...|.|.|.|.|:|   :...|. ..:|.:  .:...|||:|:....|:.....::...|...|
  Fly   145 LSKSVVYRDNIRPIC---VVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVC 206

  Fly   316 NQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGW 380
             .::..|  |:...|.|||..:. :.|.|||||||...........:...|:.||....|..   
  Fly   207 -AKFIGQ--TIAGNQFCAGNWDS-NLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQK--- 264

  Fly   381 PGVYTRVEAYLNWI 394
            ..|:|.|.::..:|
  Fly   265 ASVFTDVLSHAEFI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 76/259 (29%)
Tryp_SPc 138..397 CDD:238113 76/260 (29%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 76/259 (29%)
Tryp_SPc 45..278 CDD:238113 75/258 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463537
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.