DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG33462

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:323 Identity:98/323 - (30%)
Similarity:138/323 - (42%) Gaps:71/323 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 ICCANSRMRNQQPQWGNHPQPTQTTKPTKRSGTKLLPMAPNCG--ENFGDRVVGGNETTKREFPW 151
            |||...|::                      |.::| :..:||  .|..:|.|...   ..:.||
  Fly    11 ICCLWRRVQ----------------------GFQML-LEEDCGIPHNISERSVNAK---LAQNPW 49

  Fly   152 MALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELTGVRLGEWDASTNPDCTVGKNG 216
            ||.:|     ..||.||.|:||||.:||||||||   |.|..:| |||||::..|..||     .
  Fly    50 MAYLE-----TPKGFHCSGTLINHLFVLTAAHCV---PDDLLIT-VRLGEYNTKTKVDC-----D 100

  Fly   217 RRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFL 281
            ...|.||:.:|.|:....|..|  |:.||.|||.:|||...|:|.:.|.|:|          ||.
  Fly   101 NHLCQEPFQEYNVDMGFRHRYY--NANDQTNDIGMLRLGRRVEYLNHIRPIC----------IFA 153

  Fly   282 GRK----------VVVAGWGRTETNFTSNIKLKAELDTVPTSECNQRYATQRRTVTTKQMCAGGV 336
            ..:          .....|..|..|.||.:.....:|..|...|::.|..   .:|.:|:|||..
  Fly   154 SNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGW---NMTFEQICAGNT 215

  Fly   337 EGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWIENNVR 399
            .. ..|..|||.|.:.:.:.||:..|...|:.|.....|...   |:...:.:|.:||:..||
  Fly   216 LS-QLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNS---GILMDLLSYADWIKRVVR 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855 1/1 (100%)
Tryp_SPc 137..394 CDD:214473 85/266 (32%)
Tryp_SPc 138..397 CDD:238113 86/268 (32%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 85/256 (33%)
Tryp_SPc 48..269 CDD:214473 83/253 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463482
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.