DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and Tpsg1

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:369 Identity:109/369 - (29%)
Similarity:159/369 - (43%) Gaps:94/369 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 SEEVTEQDRRFLQASQCGYRNGQVLEKHFCFTNVQICCANSRMRNQQPQWGNHPQPTQTTKPT-- 116
            |.:||:::..::..  |....|..|.:.|                   ||.       |:|||  
Mouse    20 SHQVTDKNGHWIHL--CHGLQGPGLAESF-------------------QWA-------TSKPTVS 56

  Fly   117 -----KRSGTKLLPMAPNCG----ENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSL 172
                 ..|....:.....||    .|.|.|:|||:......:||.|.:...|.     |.|||||
Mouse    57 ARGQYPDSLANSVSSGSGCGHPQVSNSGSRIVGGHAAPAGTWPWQASLRLHKV-----HVCGGSL 116

  Fly   173 INHRYVLTAAHCVSAI--PSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERI-- 233
            ::..:|||||||.|..  .||::   |.|||...:.:|                 .:...:||  
Mouse   117 LSPEWVLTAAHCFSGSVNSSDYQ---VHLGELTVTLSP-----------------HFSTVKRIIM 161

  Fly   234 ----PHPQYPGNSRDQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRT- 293
                |.|  ||:|    .||||::|...|..|..:.|||||..::   :.:.|.:..|.|||.| 
Mouse   162 YTGSPGP--PGSS----GDIALVQLSSPVALSSQVQPVCLPEASA---DFYPGMQCWVTGWGYTG 217

  Fly   294 ---ETNFTSNIKLKAELDTVPTSECNQRYATQRRTVTTKQM-CAGGVEGVDSCRGDSGGPLLLED 354
               ......|:: :|::..|....|:|.|.:...::....| ||.|..  |:|:.||||||:.: 
Mouse   218 EGEPLKPPYNLQ-EAKVSVVDVKTCSQAYNSPNGSLIQPDMLCARGPG--DACQDDSGGPLVCQ- 278

  Fly   355 YSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWIENNV 398
               ....:..|||||:| ..||....||||.||.||:|||.:::
Mouse   279 ---VAGTWQQAGVVSWG-EGCGRPDRPGVYARVTAYVNWIHHHI 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855 7/36 (19%)
Tryp_SPc 137..394 CDD:214473 89/269 (33%)
Tryp_SPc 138..397 CDD:238113 90/271 (33%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 90/271 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.