DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and PRSS33

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001372391.1 Gene:PRSS33 / 260429 HGNCID:30405 Length:280 Species:Homo sapiens


Alignment Length:290 Identity:94/290 - (32%)
Similarity:132/290 - (45%) Gaps:60/290 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 CGE-NFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHH-CGGSLINHRYVLTAAHCV--SAIPS 190
            ||: ....|:|||.:....|:||.|.|::      :|.| ||||||..::|||||||.  .|:|:
Human    28 CGQPRMSSRIVGGRDGRDGEWPWQASIQH------RGAHVCGGSLIAPQWVLTAAHCFPRRALPA 86

  Fly   191 DW--ELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRD-QLNDIALL 252
            ::  .|..:|||    ||:|..              :..||...:..|.|   |.| ...|:|||
Human    87 EYRVRLGALRLG----STSPRT--------------LSVPVRRVLLPPDY---SEDGARGDLALL 130

  Fly   253 RLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLK-------AELDTV 310
            :||..|..|..:.|||||...::...   |....|.|||    :....:.|.       ..:..:
Human   131 QLRRPVPLSARVQPVCLPVPGARPPP---GTPCRVTGWG----SLRPGVPLPEWRPLQGVRVPLL 188

  Fly   311 PTSECNQRY------ATQRRTVTTKQMCAGGVEG-VDSCRGDSGGPLLLEDYSNGNSNYYIAGVV 368
            .:..|:..|      ....|.|....:|||..:| .|:|:|||||||....    :.::.:.|||
Human   189 DSRTCDGLYHVGADVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTCLQ----SGSWVLVGVV 249

  Fly   369 SYGPTPCGLKGWPGVYTRVEAYLNWIENNV 398
            |:| ..|.|...|||||.|..|..||:..|
Human   250 SWG-KGCALPNRPGVYTSVATYSPWIQARV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 89/276 (32%)
Tryp_SPc 138..397 CDD:238113 90/278 (32%)
PRSS33NP_001372391.1 Tryp_SPc 37..275 CDD:238113 89/276 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.