DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and TPSG1

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:328 Identity:102/328 - (31%)
Similarity:142/328 - (43%) Gaps:68/328 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 WGNHPQPTQTTKPTKRSGTKLL------------PMAPN-----CG----ENFGDRVVGGNETTK 146
            |......::..|...|.|...|            |..|:     ||    .:.|.|:|||:....
Human     7 WQTRELKSKVPKKAGRCGQGRLHGGSAVGFLGSPPGTPSSFDLGCGRPQVSDAGGRIVGGHAAPA 71

  Fly   147 REFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAI--PSDWELTGVRLGEWDASTNPD 209
            ..:||.|.:...:.     |.|||||::.::|||||||.|..  .||::   |.|||.:.:.:|.
Human    72 GAWPWQASLRLRRV-----HVCGGSLLSPQWVLTAAHCFSGSLNSSDYQ---VHLGELEITLSPH 128

  Fly   210 CTVGKNGRRDCNEPYVDYPVEERIPHPQ---YPGNSRDQLNDIALLRLRDEVQYSDFILPVCLPT 271
            .:.                |.:.|.|..   .||.|    .||||:.|...|..|..|||||||.
Human   129 FST----------------VRQIILHSSPSGQPGTS----GDIALVELSVPVTLSSRILPVCLPE 173

  Fly   272 LASQHNNIFLGRKVVVAGWGRTETN--FTSNIKLK-AELDTVPTSECNQRYATQRRTVTTKQM-C 332
            .:   ::...|.:..|.|||.|...  ......|: .::..|.|..|.:.|.....::....| |
Human   174 AS---DDFCPGIRCWVTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLC 235

  Fly   333 AGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWIENN 397
            |.|..  |:|:.||||||:.:    .|..:..||.||:| ..||....|||||||.||:|||..:
Human   236 ARGPG--DACQDDSGGPLVCQ----VNGAWVQAGTVSWG-EGCGRPNRPGVYTRVPAYVNWIRRH 293

  Fly   398 VRA 400
            :.|
Human   294 ITA 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 89/265 (34%)
Tryp_SPc 138..397 CDD:238113 90/267 (34%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 89/265 (34%)
Tryp_SPc 63..293 CDD:238113 90/267 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.