DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG30286

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:286 Identity:101/286 - (35%)
Similarity:143/286 - (50%) Gaps:37/286 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 TKLLP---------MAPNCGENFGDRVVGGNETTK---REFPWMALIEYTKPGNVKGHHCGGSLI 173
            |.|||         :.|:||....:.:  .||..:   .|.||||.:.  |.|.:.   |||:|:
  Fly     8 TSLLPWHPHATAQFLEPDCGYMSPEAL--QNEEHQAHISESPWMAYLH--KSGELV---CGGTLV 65

  Fly   174 NHRYVLTAAHCVSAIPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQY 238
            |||::||||||   |..|..|| |||||:::.|:.||    || .||..|..|:.::....|..|
  Fly    66 NHRFILTAAHC---IREDENLT-VRLGEFNSLTSIDC----NG-SDCLPPSEDFEIDVAFRHGGY 121

  Fly   239 PGNSRDQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKL 303
            ...:|  ::||.||||...|:|...|.|:||.|..:....|....::|..||||:.:...::|..
  Fly   122 SRTNR--IHDIGLLRLAKSVEYKVHIKPICLITNTTLQPKIERLHRLVATGWGRSPSEAANHILK 184

  Fly   304 KAELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVV 368
            ...:..|....|::.|...||   ..|:|.....|| ||.||||||:......:|...:...|:|
  Fly   185 SIRVTRVNWGVCSKTYWVDRR---RDQICVSHESGV-SCSGDSGGPMGQAIRLDGRVLFVQVGIV 245

  Fly   369 SYGPTPCGLKGWPGVYTRVEAYLNWI 394
            |||...| |.  |.|:|.|..:::||
  Fly   246 SYGNAEC-LS--PSVFTNVMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 92/259 (36%)
Tryp_SPc 138..397 CDD:238113 94/260 (36%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 92/253 (36%)
Tryp_SPc 39..268 CDD:214473 90/251 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463581
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.