DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG30187

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:270 Identity:84/270 - (31%)
Similarity:125/270 - (46%) Gaps:34/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 CGENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWEL 194
            ||.|...::.||:....:...|||.:.     |.....|||:||:.|:|||||||:    .|.::
  Fly    28 CGINIALKITGGHNAAFQNSVWMAAVH-----NRTHFICGGTLIHKRFVLTAAHCI----VDQDV 83

  Fly   195 TGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQ 259
            ..|.||.::.|...|       |:|.....|....:.|..:.          |||.||:|..:|.
  Fly    84 QSVSLGAYNKSDPAD-------RKDVITAVVHSSFDVRASYE----------NDIGLLKLSSDVI 131

  Fly   260 YSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVPTSECNQRYATQRR 324
            ::..|.|:|:....|..|::...|.....|||....|.||:|.....|:.:...||   |.....
  Fly   132 FNALIRPICIVLNKSMANHMRNMRTFKAFGWGTLRGNKTSDILQTIILNHLDREEC---YMELSV 193

  Fly   325 TVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIA-GVVSYGPTPCGLKGWPGVYTRVE 388
            ..:.||:|||...| |:|.|||||||..:.:..|..|..:. |::|.|.|.|   ...||||.:.
  Fly   194 YPSEKQICAGVPSG-DTCGGDSGGPLTNDVFIQGIGNREVQFGIISVGKTSC---DGQGVYTDLM 254

  Fly   389 AYLNWIENNV 398
            ::.:||:..:
  Fly   255 SFADWIKMTI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 79/257 (31%)
Tryp_SPc 138..397 CDD:238113 81/259 (31%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 79/257 (31%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.