DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG30091

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:290 Identity:90/290 - (31%)
Similarity:134/290 - (46%) Gaps:38/290 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 RSGTKLLPMAPNCG--ENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLT 180
            |...:||.  .:||  .....::|||.:..:.:.||||||: |....:    ||||:|.:::|||
  Fly    17 RGSARLLD--EDCGVPMQLIPKIVGGVDAGELKNPWMALIK-TNDEFI----CGGSVITNKFVLT 74

  Fly   181 AAHCV----SAIPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGN 241
            ||||:    ..|....:|| |.||.:..     ...|::     |.|:..|.||....|..:.  
  Fly    75 AAHCMCTDEECIVKYTQLT-VTLGVYHL-----LATGEH-----NHPHEIYNVERVYIHDSFA-- 126

  Fly   242 SRDQLNDIALLRLRDEVQYSDFILPVCL---PTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKL 303
            .::..||||||||:..:.|...|.|:|:   ..|..|.:.|   ::....|||.|.....||...
  Fly   127 IQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLI---QEFTAIGWGVTGNGKMSNNLQ 188

  Fly   304 KAELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVV 368
            ..::..:....|.   |....|......|||...|.|:|:.||||||.:....:|.......|:|
  Fly   189 MVKIYRIDRKMCE---AAFWYTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIV 250

  Fly   369 SYGPTPCGLKGWPGVYTRVEAYLNWIENNV 398
            |.|...|  :|: |:||.|..::::||..|
  Fly   251 STGTEDC--RGF-GMYTDVMGHIDFIERIV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 82/263 (31%)
Tryp_SPc 138..397 CDD:238113 84/265 (32%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 82/263 (31%)
Tryp_SPc 37..276 CDD:238113 84/265 (32%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463570
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.