DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG30090

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:278 Identity:95/278 - (34%)
Similarity:131/278 - (47%) Gaps:28/278 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 MAPNCG---ENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSA 187
            :.|.||   .....:::||.:......||||.|.    .:|| ..|||:||..|:||||||||  
  Fly    25 LEPRCGLTANTIAFKIIGGRDAIINSNPWMAYIH----SSVK-LICGGTLITQRFVLTAAHCV-- 82

  Fly   188 IPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALL 252
              ::.....|||||:|.:...||     ..:.|.....::.|:....|.::  :....|||||||
  Fly    83 --NEGSAVKVRLGEYDDTATEDC-----NSKICIPRAEEHDVDMAFRHGKF--SEIKNLNDIALL 138

  Fly   253 RLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVPTSECNQ 317
            ||...|.:...|.|:|:....|:...:......|..|||.|.|:.|..:....:|....:|:|.|
  Fly   139 RLAKFVTFKAHISPICIILGTSKRELVDSIEWFVATGWGETRTHRTRGVLQITQLQRYNSSQCMQ 203

  Fly   318 RYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPC-GLKGWP 381
            ...   |.|...|:|||.: |.|:|.|||||||...............||||||...| |:    
  Fly   204 ALG---RLVQQNQICAGRL-GSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGI---- 260

  Fly   382 GVYTRVEAYLNWIENNVR 399
            ||||.|.:|.:||...|:
  Fly   261 GVYTDVYSYADWIATVVQ 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 89/257 (35%)
Tryp_SPc 138..397 CDD:238113 91/259 (35%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 89/257 (35%)
Tryp_SPc 40..276 CDD:238113 91/259 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463647
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.