DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG30082

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:272 Identity:98/272 - (36%)
Similarity:133/272 - (48%) Gaps:31/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 PNCGENFG----DRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAI 188
            ||||....    :|:|||........||:|.:.  |..::.   |.|:||..|:|||||||:.: 
  Fly    26 PNCGTTINLPPTNRIVGGRTADIGSNPWLAYLH--KNSSLV---CTGTLITKRFVLTAAHCLHS- 84

  Fly   189 PSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLR 253
               :.|..|||||:|.||..|||     ...|...|.:|.||....|..: |..:|..|||.||:
  Fly    85 ---FHLLTVRLGEYDTSTRIDCT-----SEFCIPTYEEYSVENAYIHTFF-GGRQDSRNDIGLLK 140

  Fly   254 LRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVPTSECNQR 318
            |...|.|..||.|:|   |......:........||||:.:...|:.:.....|..:..|:|.: 
  Fly   141 LNGTVVYKLFIRPIC---LFRDPGQVPYSSTYEAAGWGKIDLINTATVLQTVNLIRLDQSDCER- 201

  Fly   319 YATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYI-AGVVSYGPTPCGLKGWPG 382
              :.|.:::..|.|||... .|:|.|||||| |....|||.....: .|:||||...|  :| ||
  Fly   202 --SLRTSLSYGQFCAGQWR-ADTCSGDSGGP-LSRKMSNGRITRTVQLGIVSYGHYLC--RG-PG 259

  Fly   383 VYTRVEAYLNWI 394
            |||.|.::.|||
  Fly   260 VYTYVPSFTNWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 92/257 (36%)
Tryp_SPc 138..397 CDD:238113 93/258 (36%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 92/257 (36%)
Tryp_SPc 40..274 CDD:238113 93/258 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463471
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.