DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and try-5

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:303 Identity:74/303 - (24%)
Similarity:112/303 - (36%) Gaps:78/303 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 GTKLLPMAPNCGENFGDRVVGGNETTKREF----------------PWMALIEYTKPGNVKGHH- 167
            ||||        :.:.|.:. |.::|...|                ||...|      .||... 
 Worm    18 GTKL--------KYYNDELC-GRQSTYTSFMLTDAAGNTGNPTHLAPWAVQI------RVKARKG 67

  Fly   168 -----CGGSLINHRYVLTAAHCV-------------SAIPSDWELTGVRLGEWDASTNPDCTVGK 214
                 |||:||..::|||||||.             :::...:..:..|..:.:..|....|||.
 Worm    68 DFEVICGGTLITLKHVLTAAHCFQKHFGAKKEGGEENSMSGRYCESNQRFTDSEILTRTVVTVGA 132

  Fly   215 NGRR-----DC-NEPYVDYPVE-ERIPHPQYPGNSRDQLNDIALLRLR---DEVQYSDFILPVCL 269
            ...|     .| ||......:: .|.....:.....:|.|||.:|.|.   |:|:.:::   .||
 Worm   133 MCTRLEQKYGCVNEKQNGKTLKISRFAIGDFYKTHCEQGNDIVILELESTIDDVEGANY---ACL 194

  Fly   270 PTLASQHNNIFLGRKVVVAGWGRTETNFTSNIK------LKAELDTVPTSECNQRYATQRRTVTT 328
            |.|...  ||..|..|...|||........|..      |....:|:.|  |.:.:.|   ::..
 Worm   195 PFLPEV--NIQSGANVTSFGWGSDPGKGFDNAAFPMIQVLTLATETLAT--CEENWGT---SIPF 252

  Fly   329 KQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYG 371
            ...|....|..:.|.|||||.|..  :.:.::..:|..:||||
 Worm   253 DSFCTAEEEDKNVCSGDSGGGLTF--HQSDSAREFIIAIVSYG 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 69/286 (24%)
Tryp_SPc 138..397 CDD:238113 69/285 (24%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 66/264 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.