DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and try-10

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:225 Identity:60/225 - (26%)
Similarity:90/225 - (40%) Gaps:58/225 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 CGGSLINHRYVLTAAHCVSAIPSDWELTG-VRLGEWDASTNPD---------CTVGKNGRRDCNE 222
            |||.||....|:|:||||.: ..|:.:|. |.||:...:.:.|         ..:.|....|.:|
 Worm   104 CGGVLIAPSIVITSAHCVFS-GDDFAVTAKVTLGDVHLNKHDDGEQEFRSHAMAISKKFFNDASE 167

  Fly   223 PYVDYPVEERIPHPQYPGNSRDQLNDIALLRL--RDEVQYSDFILPVC-LPTLASQH-------N 277
            ..                      :|:|::.|  |.:|.:|...|.:. ||:..|.:       .
 Worm   168 AN----------------------DDVAVIFLPQRADVCHSPLSLQIAKLPSTGSVNFKETAPLT 210

  Fly   278 NIFLGRKV-VVAGWGRTETNFTSNIKLKAELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGVD- 340
            .:.|...| .|||||:|| |.|:...     |:|.....|   .:.||....|.:.|..|.|.. 
 Worm   211 QLQLETSVCYVAGWGKTE-NKTAKYS-----DSVRQMMVN---LSVRRIGKRKYLIAKAVTGSSR 266

  Fly   341 SCRGDSGGPLLLEDYSNGNSNYYIAGVVSY 370
            :|.||||.|:    |...|....:.|.|::
 Worm   267 ACMGDSGSPV----YCFVNGKRILVGTVAH 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 60/225 (27%)
Tryp_SPc 138..397 CDD:238113 60/225 (27%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 59/221 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.