DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and try-1

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:282 Identity:88/282 - (31%)
Similarity:126/282 - (44%) Gaps:65/282 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 RVVGGNETTKREFPW-MALIEYTKPGNVKGHH-CGGSLINHRYVLTAAHCVS--AIPSDWELTGV 197
            |::||:|::...:|| :.|:...      ||| ||||||:..:|||||||.:  ..|:.:   .|
 Worm    57 RLIGGSESSPHSWPWTVQLLSRL------GHHRCGGSLIDPNFVLTAAHCFAKDRRPTSY---SV 112

  Fly   198 RLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIP----HPQY----PGNSRDQLNDIALLRL 254
            |:|              ..|.....|:       |:.    ||.|    |.:     .|.|::|:
 Worm   113 RVG--------------GHRSGSGSPH-------RVTAVSIHPWYNIGFPSS-----YDFAIMRI 151

  Fly   255 RDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVP---TSECN 316
            ...|..|....|:|||:|.:..|     |..||.|||.|....:.:.....|:. ||   |..|:
 Worm   152 HPPVNTSTTARPICLPSLPAVEN-----RLCVVTGWGSTIEGSSLSAPTLREIH-VPLLSTLFCS 210

  Fly   317 QRYATQRRTVTTKQMCAGGVEG-VDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGW 380
            .......|......:|||...| :|||:|||||||:..    .:.::.:.||||:| ..|...|.
 Worm   211 SLPNYIGRIHLPSMLCAGYSYGKIDSCQGDSGGPLMCA----RDGHWELTGVVSWG-IGCARPGM 270

  Fly   381 PGVYTRVEAYLNWIE---NNVR 399
            ||||..|.:...||.   |.:|
 Worm   271 PGVYGNVHSASTWINLEMNRLR 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 84/272 (31%)
Tryp_SPc 138..397 CDD:238113 85/277 (31%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 84/271 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.