DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and Tpsb2

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:278 Identity:87/278 - (31%)
Similarity:123/278 - (44%) Gaps:54/278 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 VVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELTGVRLGEW 202
            :|||:|.::.::||...:.:..  |...|.||||||:.::||||||||.......:|..|:|   
Mouse    32 IVGGHEASESKWPWQVSLRFKL--NYWIHFCGGSLIHPQWVLTAAHCVGPHIKSPQLFRVQL--- 91

  Fly   203 DASTNPDCTVGKNGRRDCNEPYVDY-----PVEERIPHPQY---PGNSRDQLNDIALLRLRDEVQ 259
                              .|.|:.|     .:...:.||.|   .|.:     |:|||.|...|.
Mouse    92 ------------------REQYLYYGDQLLSLNRIVVHPHYYTAEGGA-----DVALLELEVPVN 133

  Fly   260 YSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETN--FTSNIKLK-AELDTVPTSECNQRYAT 321
            .|..:.|:.||..:.....   |....|.|||..:.:  ......|| .::..|..|.|:::|.|
Mouse   134 VSTHLHPISLPPASETFPP---GTSCWVTGWGDIDNDEPLPPPYPLKQVKVPIVENSLCDRKYHT 195

  Fly   322 QRRT------VTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGW 380
            ...|      |....:|||.... |||:|||||||:.:    ....:..|||||:| ..|.....
Mouse   196 GLYTGDDFPIVHDGMLCAGNTRR-DSCQGDSGGPLVCK----VKGTWLQAGVVSWG-EGCAQPNK 254

  Fly   381 PGVYTRVEAYLNWIENNV 398
            ||:||||..||:||...|
Mouse   255 PGIYTRVTYYLDWIHRYV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 84/272 (31%)
Tryp_SPc 138..397 CDD:238113 86/275 (31%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 86/274 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.