DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG43336

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:288 Identity:98/288 - (34%)
Similarity:133/288 - (46%) Gaps:49/288 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 TKLLPMAPNCGENFGD----RVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTA 181
            |:.|.||  ||.....    ||..|...:....||||.:..|....:    ||||||.:|.||||
  Fly    19 TQFLDMA--CGIRAHSPSVPRVKNGTVASLTSSPWMAFLHSTDGRFI----CGGSLITNRLVLTA 77

  Fly   182 AHCVSAIPSDWELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIP----HPQYPGNS 242
            |||   .....||. .||||:|          :.....|::.|..|.:|..:.    |..|  |.
  Fly    78 AHC---FLDRTELV-ARLGEYD----------REEYEMCHDSYCTYRIEAMVERGFRHRHY--NP 126

  Fly   243 RDQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAEL 307
            .....|||:|||..:|||:|.|.|:|:.........|.....:...|||:||:...|     |:|
  Fly   127 MTMAYDIAILRLYRKVQYTDNIRPICIVIDPRWRKYIDSLDPLTGTGWGKTESEGDS-----AKL 186

  Fly   308 DTVPTS----ECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPL-LLEDYSNGNSNYYI-AG 366
            .||..:    |..:||||  .::|..|.|||. |..:.|.||||||: .|..|  |.|..:: .|
  Fly   187 RTVDLARKHPEVCRRYAT--LSLTANQFCAGN-ERSNLCNGDSGGPVGALIPY--GKSKRFVQVG 246

  Fly   367 VVSYGPTPCGLKGWPGVYTRVEAYLNWI 394
            :.|:..|.|.:   ..|:|.|.:|::||
  Fly   247 IASFTNTQCVM---VSVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 90/266 (34%)
Tryp_SPc 138..397 CDD:238113 91/267 (34%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 90/266 (34%)
Tryp_SPc 40..271 CDD:238113 88/263 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463702
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.