DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG43124

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:254 Identity:65/254 - (25%)
Similarity:98/254 - (38%) Gaps:76/254 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 PWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELTGVRLGEWDASTNPDCTVGK 214
            ||:|  |......|   .|.|:|||:.||||||.|   ...:.:|| ||||              
  Fly    41 PWLA--EILSDSKV---ICAGALINNLYVLTAASC---FKENEKLT-VRLG-------------- 82

  Fly   215 NGRRDCNEPYVDYPVEER---IPHPQYPGNSRDQLNDIALLRLRDEVQYSDFILPVCLPT----- 271
            :|..|  :.|.::.|.:.   :.|  :|.|:   .|::.:.||:.||::...|.|:|:..     
  Fly    83 SGYFD--KSYENFRVTKAYFWMTH--FPANN---TNNLCIFRLQTEVEFKTHIRPMCITKSPKSL 140

  Fly   272 -LASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVPTSECNQRYATQRRTVTTKQMCAGG 335
             ||:....|....|:    |     .|..|||         ...|...:........:|...:..
  Fly   141 GLATTFEIINEKPKM----W-----YFCKNIK---------GLFCKYVFGENEEKWQSKPTGSPW 187

  Fly   336 VEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWI 394
            .|.:      |.||.      .|...|   |::||...    |.:..||..|.:::|||
  Fly   188 TETI------SNGPF------KGLVRY---GILSYRDN----KTYDEVYINVMSHINWI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 63/252 (25%)
Tryp_SPc 138..397 CDD:238113 65/254 (26%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 37/121 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.