DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MP1 and CG43125

DIOPT Version :9

Sequence 1:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:287 Identity:74/287 - (25%)
Similarity:111/287 - (38%) Gaps:94/287 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 NCGENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDW- 192
            |||::          :.....||:..|......|:.   |.|:|||.|:|||||.|:     |: 
  Fly    26 NCGKS----------SVFSPAPWLVKIRPELSSNIT---CTGTLINERFVLTAASCI-----DYQ 72

  Fly   193 -ELTGVRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRD 256
             ||. |||||.|.      |:..:.:....|.|    |...:.|..|...|. |.| ||||||:.
  Fly    73 TELI-VRLGEIDG------TLQNSSKLQYEEIY----VARALIHRSYSSESH-QYN-IALLRLKT 124

  Fly   257 EVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETNFTSNIKLKAELDTVPTSECNQRYAT 321
            .|.|...|.|:|:        ::.:|:                       :...||.|..     
  Fly   125 SVVYKKNIQPICI--------DVNVGK-----------------------VPKAPTFEIE----- 153

  Fly   322 QRRTVTTKQMCAG----------GVEGVDSCRGD---------SGGPLLLEDYSNGNSNYYIAGV 367
            :::....|:..||          .:.||...|.|         .|.||..:  .|.::.::..|:
  Fly   154 KKKNEEPKKNKAGIMKRFLNWFLSLFGVREPRPDVILPPQPIAVGWPLTKQ--INESALFHQYGI 216

  Fly   368 VSYGPTPCGLKGWPGVYTRVEAYLNWI 394
            :|:..:    :....|||.|.||:|||
  Fly   217 LSHRNS----ESKKDVYTDVMAYVNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 69/277 (25%)
Tryp_SPc 138..397 CDD:238113 71/278 (26%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 44/120 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463614
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.